PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G107300.2
Common NameB456_006G107300, LOC105799169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 518aa    MW: 58035.6 Da    PI: 4.5769
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G107300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.12.7e-10364407146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         r rW++++ el++ a++q+G++ +++I + ++ gR++ q+k+++ +
  Gorai.006G107300.2 364 RARWSKQDTELFYGAIRQFGPD-FSLIQQLFP-GRSRHQIKLKFKN 407
                         569*****************88.*********.**********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159632.9E-25360439No hitNo description
Gene3DG3DSA:1.10.10.602.1E-6362408IPR009057Homeodomain-like
PROSITE profilePS5129310.632362413IPR017884SANT domain
SMARTSM007171.3E-8363411IPR001005SANT/Myb domain
CDDcd001675.49E-7366407No hitNo description
SuperFamilySSF466893.51E-10366414IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MFGMTTASGR RTEKFKPKPR LQTSVPASPP TVVEWVMHPA TARFVPSETA FKEGSIPDFP  60
SDHVPNCAPV DLGSFIPPDP STSECPVNEE LANLAVSSNA GVDLSGDVPD MPTEVISTIM  120
ERNASLVSNP SRESKQSSTG GEVNGEGKAR KQLREQVTTP HNVDDLEDGT CNDDGLDAEL  180
PSYYAIDEDK DDNDDDEFNV EHASPKRRTS KRSKKPVNES EKPPRKRRKA NEAQKHKKAN  240
EASDNPEKEQ RKKFSHSTRR KRRFVDESLL TTPEDEIDFA KVALKDLILL ADYKERIAKK  300
EAKALKEPLT DQSTQKRLNE ENARDEESSI ASEQDQGIMD DQVNGSAQSD IYFNYQTLMT  360
KEPRARWSKQ DTELFYGAIR QFGPDFSLIQ QLFPGRSRHQ IKLKFKNEER RSPFKLSEAL  420
ASRASDHSYF AKVIEQLQQV SGADPEAHGD VSNDLTREEE EVTPENNEEA AKPKQDEDVA  480
VGDQEADITQ DHSSLKSNEM DDEDDDDEIL NSYQSAF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1205227KRRTSKRSKKPVNESEKPPRKRR
2206212RRTSKRS
3213228KKPVNESEKPPRKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485033.10.0PREDICTED: transcription factor TFIIIB component B'' homolog isoform X1
TrEMBLA0A0D2NQ130.0A0A0D2NQ13_G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.12e-39MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]